MonoMethyl-Histone H3-K9 Rabbit mAb, Clone: [ARC2677], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20734S
Artikelname: MonoMethyl-Histone H3-K9 Rabbit mAb, Clone: [ARC2677], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20734S
Hersteller Artikelnummer: CNA20734S
Alternativnummer: MBL-CNA20734S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, DOT, ICC, IF, IHC-P, WB
Spezies Reaktivität: All, Human, Mouse, Rat
Immunogen: A synthetic monomethylated peptide around K9 of human Histone H3 (P68431).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2677]
Molekulargewicht: 16kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target-Kategorie: A synthetic monomethylated peptide around K9 of human Histone H3 (P68431).
Application Verdünnung: WB: DB,1:500 - 1:1000|WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ChIP,1:50 - 1:200|CUT&Tag, 105 cells /1 µg