CSNK2A2 Rabbit mAb, Clone: [ARC51360], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA20791P
| Artikelname: |
CSNK2A2 Rabbit mAb, Clone: [ARC51360], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA20791P |
| Hersteller Artikelnummer: |
CNA20791P |
| Alternativnummer: |
MBL-CNA20791P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC51360] |
| Molekulargewicht: |
41kDa |
| Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequenz: |
LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
| Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1). |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000|IP,1:50 - 1:200 |
