YKL-40/CHI3L1 Rabbit mAb, Clone: [ARC51312], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20792P
Artikelname: YKL-40/CHI3L1 Rabbit mAb, Clone: [ARC51312], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20792P
Hersteller Artikelnummer: CNA20792P
Alternativnummer: MBL-CNA20792P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51312]
Molekulargewicht: 43kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200