S100P Rabbit mAb, Clone: [ARC50711], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20795P
Artikelname: S100P Rabbit mAb, Clone: [ARC50711], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20795P
Hersteller Artikelnummer: CNA20795P
Alternativnummer: MBL-CNA20795P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50711]
Molekulargewicht: 10kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200