CD68 Rabbit mAb, Clone: [ARC51150], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA20803P
Artikelname: |
CD68 Rabbit mAb, Clone: [ARC51150], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA20803P |
Hersteller Artikelnummer: |
CNA20803P |
Alternativnummer: |
MBL-CNA20803P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
FC, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC51150] |
Molekulargewicht: |
37kDa |
Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Sequenz: |
TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK |
Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2). |
Application Verdünnung: |
WB: WB,1:500 - 1:1000|FC,1:50 - 1:200 |