[KO Validated] SIRT3 Rabbit mAb, Clone: [ARC51526], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20805P
Artikelname: [KO Validated] SIRT3 Rabbit mAb, Clone: [ARC51526], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20805P
Hersteller Artikelnummer: CNA20805P
Alternativnummer: MBL-CNA20805P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51526]
Molekulargewicht: 44kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000