SLFN11 Rabbit mAb, Clone: [ARC51651], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20809P
Artikelname: SLFN11 Rabbit mAb, Clone: [ARC51651], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20809P
Hersteller Artikelnummer: CNA20809P
Alternativnummer: MBL-CNA20809P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51651]
Molekulargewicht: 103kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: LYRRSETSVRSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPESQLVEFKQFSTKHFQEYVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVNVLKRGELYGYACMIRVNPFCCAVFSEA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3).
Application Verdünnung: WB: WB,1:500 - 1:1000