GSK3beta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2081S1
Artikelname: GSK3beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2081S1
Hersteller Artikelnummer: CNA2081S1
Alternativnummer: MBL-CNA2081S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 320 to the C-terminus of human GSK3beta (NP_001139628.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 320 to the C-terminus of human GSK3beta (NP_001139628.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200