TROP-2 Rabbit mAb, Clone: [ARC51513], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20824P
Artikelname: TROP-2 Rabbit mAb, Clone: [ARC51513], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20824P
Hersteller Artikelnummer: CNA20824P
Alternativnummer: MBL-CNA20824P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51513]
Molekulargewicht: 36kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200