[KO Validated] Hexokinase II Rabbit mAb, Clone: [ARC52060], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20829P
Artikelname: [KO Validated] Hexokinase II Rabbit mAb, Clone: [ARC52060], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20829P
Hersteller Artikelnummer: CNA20829P
Alternativnummer: MBL-CNA20829P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52060]
Molekulargewicht: 102kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200