Prdm9 Rabbit mAb, Clone: [ARC51589], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20832P
Artikelname: Prdm9 Rabbit mAb, Clone: [ARC51589], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20832P
Hersteller Artikelnummer: CNA20832P
Alternativnummer: MBL-CNA20832P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51589]
Molekulargewicht: 97kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIF
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000