TET1 Rabbit mAb, Clone: [ARC51466], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20833P
Artikelname: TET1 Rabbit mAb, Clone: [ARC51466], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20833P
Hersteller Artikelnummer: CNA20833P
Alternativnummer: MBL-CNA20833P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51466]
Molekulargewicht: 219kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: HNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1).
Application Verdünnung: WB: IHC-P,1:50 - 1:200