SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20834P
Artikelname: SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20834P
Hersteller Artikelnummer: CNA20834P
Alternativnummer: MBL-CNA20834P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51489]
Molekulargewicht: 141kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1).
Application Verdünnung: WB: WB,1:2000 - 1:10000|IF/ICC,1:50 - 1:200