Ret Rabbit mAb, Clone: [ARC51764], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20845P
Artikelname: Ret Rabbit mAb, Clone: [ARC51764], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20845P
Hersteller Artikelnummer: CNA20845P
Alternativnummer: MBL-CNA20845P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ret (NP_066124.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51764]
Molekulargewicht: 124kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: DISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWM
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ret (NP_066124.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200