Lipocalin-2/NGAL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2092S1
Artikelname: Lipocalin-2/NGAL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2092S1
Hersteller Artikelnummer: CNA2092S1
Alternativnummer: MBL-CNA2092S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-198 of human Lipocalin-2/NGAL (NP_005555.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 21-198 of human Lipocalin-2/NGAL (NP_005555.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200