Raptor Rabbit mAb, Clone: [ARC52274], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20984P
Artikelname: Raptor Rabbit mAb, Clone: [ARC52274], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20984P
Hersteller Artikelnummer: CNA20984P
Alternativnummer: MBL-CNA20984P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human Raptor (NP_065812.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52274]
Molekulargewicht: 149kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human Raptor (NP_065812.1).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:500 - 1:1000