XRCC2 Rabbit mAb, Clone: [ARC52032], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA20990P
Artikelname: |
XRCC2 Rabbit mAb, Clone: [ARC52032], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA20990P |
Hersteller Artikelnummer: |
CNA20990P |
Alternativnummer: |
MBL-CNA20990P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC52032] |
Molekulargewicht: |
32kDa |
Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Sequenz: |
MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1). |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |