[KO Validated] FTO Rabbit mAb, Clone: [ARC52114], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20992P
Artikelname: [KO Validated] FTO Rabbit mAb, Clone: [ARC52114], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20992P
Hersteller Artikelnummer: CNA20992P
Alternativnummer: MBL-CNA20992P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 327-504 of human FTO (NP_001073901.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52114]
Molekulargewicht: 58kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: STGTLDYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 327-504 of human FTO (NP_001073901.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200