Syk Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2123S
Artikelname: Syk Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2123S
Hersteller Artikelnummer: CNA2123S
Alternativnummer: MBL-CNA2123S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Syk (NP_001128524.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 72kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPASSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Syk (NP_001128524.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200