CD90/Thy1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2126P
Artikelname: CD90/Thy1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2126P
Hersteller Artikelnummer: CNA2126P
Alternativnummer: MBL-CNA2126P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200