[KO Validated] Caspase-3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2156T
Artikelname: [KO Validated] Caspase-3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2156T
Hersteller Artikelnummer: CNA2156T
Alternativnummer: MBL-CNA2156T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200