[KO Validated] eIF4E Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2162S
Artikelname: [KO Validated] eIF4E Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2162S
Hersteller Artikelnummer: CNA2162S
Alternativnummer: MBL-CNA2162S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100