HCLS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2165S
Artikelname: HCLS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2165S
Hersteller Artikelnummer: CNA2165S
Alternativnummer: MBL-CNA2165S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human HCLS1 (NP_005326.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human HCLS1 (NP_005326.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200