KAT2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2224S
Artikelname: KAT2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2224S
Hersteller Artikelnummer: CNA2224S
Alternativnummer: MBL-CNA2224S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 94kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200