Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: MBL-CNA2252S
• Hersteller Artikelnummer: CNA2252S
• Alternativnummer: MBL-CNA2252S
• Hersteller: MBL
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IP, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1).
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 44kDa
• Puffer: PBS with 0.02% sodium azide,50% glycerol
• Quelle: Rabbit
• Reinheit: Affinity purification
• Formulierung: PBS with 0.02% sodium azide,50% glycerol
• Sequenz: MSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC
• Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1).

Anwendungsbeschreibung

• Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:20 - 1:50