SMURF2 Rabbit mAb, Clone: [ARC1897], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2278S
Artikelname: SMURF2 Rabbit mAb, Clone: [ARC1897], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2278S
Hersteller Artikelnummer: CNA2278S
Alternativnummer: MBL-CNA2278S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1897]
Molekulargewicht: 86kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000