[KO Validated] EDF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2283S
Artikelname: [KO Validated] EDF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2283S
Hersteller Artikelnummer: CNA2283S
Alternativnummer: MBL-CNA2283S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human EDF1 (NP_003783.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human EDF1 (NP_003783.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100