Zyxin Rabbit mAb, Clone: [ARC1906], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2298S
Artikelname: Zyxin Rabbit mAb, Clone: [ARC1906], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2298S
Hersteller Artikelnummer: CNA2298S
Alternativnummer: MBL-CNA2298S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1906]
Molekulargewicht: 61kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200