GCN2 Rabbit mAb, Clone: [ARC52336], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2307P
Artikelname: GCN2 Rabbit mAb, Clone: [ARC52336], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2307P
Hersteller Artikelnummer: CNA2307P
Alternativnummer: MBL-CNA2307P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GCN2 (NP_001013725.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52336]
Molekulargewicht: 69kDa/183kDa/186kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQRRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQYS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GCN2 (NP_001013725.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500