GRASP65 Rabbit mAb, Clone: [ARC1911], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2316S
Artikelname: GRASP65 Rabbit mAb, Clone: [ARC1911], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2316S
Hersteller Artikelnummer: CNA2316S
Alternativnummer: MBL-CNA2316S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 341-440 of human GRASP65 (Q9BQQ3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1911]
Molekulargewicht: 46kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 341-440 of human GRASP65 (Q9BQQ3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200