Histone H3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2348P
Artikelname: Histone H3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2348P
Hersteller Artikelnummer: CNA2348P
Alternativnummer: MBL-CNA2348P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: All, Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Application Verdünnung: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:300 - 1:700|ChIP,1:200 - 1:400