DNPH1 Rabbit mAb, Clone: [ARC2571], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2382S
Artikelname: DNPH1 Rabbit mAb, Clone: [ARC2571], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2382S
Hersteller Artikelnummer: CNA2382S
Alternativnummer: MBL-CNA2382S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 75-174 of human DNPH1 (O43598).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2571]
Molekulargewicht: 19kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 75-174 of human DNPH1 (O43598).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200