LEFTY1/2 Rabbit mAb, Clone: [ARC2149], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2387S
Artikelname: LEFTY1/2 Rabbit mAb, Clone: [ARC2149], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2387S
Hersteller Artikelnummer: CNA2387S
Alternativnummer: MBL-CNA2387S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 267-366 of human LEFTY1/2 (O75610).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2149]
Molekulargewicht: 34.44kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 267-366 of human LEFTY1/2 (O75610).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200