CRMP1 Rabbit mAb, Clone: [ARC1918], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2390S
Artikelname: CRMP1 Rabbit mAb, Clone: [ARC1918], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2390S
Hersteller Artikelnummer: CNA2390S
Alternativnummer: MBL-CNA2390S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CRMP1 (Q14194).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1918]
Molekulargewicht: 62kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNN
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CRMP1 (Q14194).
Application Verdünnung: WB: WB,1:500 - 1:2000