TCTP/TPT1 Rabbit mAb, Clone: [ARC0743], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2394S
Artikelname: TCTP/TPT1 Rabbit mAb, Clone: [ARC0743], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2394S
Hersteller Artikelnummer: CNA2394S
Alternativnummer: MBL-CNA2394S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCTP/TPT1 (P13693).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0743]
Molekulargewicht: 20kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCTP/TPT1 (P13693).
Application Verdünnung: WB: WB,1:500 - 1:2000| IHC-P,1:50 - 1:200|IP,1:500 - 1:1000