ROCK2 Rabbit mAb, Clone: [ARC0744], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2395S
Artikelname: ROCK2 Rabbit mAb, Clone: [ARC0744], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2395S
Hersteller Artikelnummer: CNA2395S
Alternativnummer: MBL-CNA2395S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1289-1388 of human ROCK2 (O75116).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0744]
Molekulargewicht: 161kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1289-1388 of human ROCK2 (O75116).
Application Verdünnung: WB: WB,1:500 - 1:2000| IHC-P,1:50 - 1:200