Peroxiredoxin 3 (PRDX3) Rabbit mAb, Clone: [ARC0747], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2398S
Artikelname: Peroxiredoxin 3 (PRDX3) Rabbit mAb, Clone: [ARC0747], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2398S
Hersteller Artikelnummer: CNA2398S
Alternativnummer: MBL-CNA2398S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0747]
Molekulargewicht: 28kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200