CDK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2438S
Artikelname: CDK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2438S
Hersteller Artikelnummer: CNA2438S
Alternativnummer: MBL-CNA2438S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200