Glycogen synthase 1 (GYS1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2519S
Artikelname: Glycogen synthase 1 (GYS1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2519S
Hersteller Artikelnummer: CNA2519S
Alternativnummer: MBL-CNA2519S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 488-737 of human Glycogen synthase 1 (Glycogen synthase 1 (GYS1)) (NP_002094.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 84kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 488-737 of human Glycogen synthase 1 (Glycogen synthase 1 (GYS1)) (NP_002094.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100