DKK3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2527P
Artikelname: DKK3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2527P
Hersteller Artikelnummer: CNA2527P
Alternativnummer: MBL-CNA2527P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human DKK3 (NP_056965.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMAT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human DKK3 (NP_056965.3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200