Integrin beta 3 (ITGB3/CD61) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2542S
Artikelname: Integrin beta 3 (ITGB3/CD61) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2542S
Hersteller Artikelnummer: CNA2542S
Alternativnummer: MBL-CNA2542S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-718 of human Integrin beta 3 (ITGB3/CD61) (NP_000203.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 87kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 610-718 of human Integrin beta 3 (ITGB3/CD61) (NP_000203.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200