DARPP32 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2580T
Artikelname: DARPP32 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2580T
Hersteller Artikelnummer: CNA2580T
Alternativnummer: MBL-CNA2580T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGY
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200