ALDH4A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2595S
Artikelname: ALDH4A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2595S
Hersteller Artikelnummer: CNA2595S
Alternativnummer: MBL-CNA2595S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 354-563 of human ALDH4A1 (NP_003739.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 62kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 354-563 of human ALDH4A1 (NP_003739.2).
Application Verdünnung: WB: WB,1:2000 - 1:7000|IF/ICC,1:50 - 1:200