Gelsolin Rabbit mAb, Clone: [ARC1924], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2612S
Artikelname: Gelsolin Rabbit mAb, Clone: [ARC1924], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2612S
Hersteller Artikelnummer: CNA2612S
Alternativnummer: MBL-CNA2612S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Gelsolin (NP_000168.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1924]
Molekulargewicht: 86kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Gelsolin (NP_000168.1).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200