Cyclin A1/A2 Rabbit mAb, Clone: [ARC2642], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2635S
Artikelname: Cyclin A1/A2 Rabbit mAb, Clone: [ARC2642], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2635S
Hersteller Artikelnummer: CNA2635S
Alternativnummer: MBL-CNA2635S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-465 of human Cyclin A1/A2 (P20248).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2642]
Molekulargewicht: 52kDa/49kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 250-465 of human Cyclin A1/A2 (P20248).
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000