COX5B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2640S
Artikelname: COX5B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2640S
Hersteller Artikelnummer: CNA2640S
Alternativnummer: MBL-CNA2640S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 32-129 of human COX5B (NP_001853.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 14kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 32-129 of human COX5B (NP_001853.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|IP,1:50 - 1:100