Cathepsin E (CTSE) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2678P
Artikelname: Cathepsin E (CTSE) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2678P
Hersteller Artikelnummer: CNA2678P
Alternativnummer: MBL-CNA2678P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (P14091).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (P14091).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200