TrkA+B+C Rabbit mAb, Clone: [ARC2649], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2693S
Artikelname: TrkA+B+C Rabbit mAb, Clone: [ARC2649], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2693S
Hersteller Artikelnummer: CNA2693S
Alternativnummer: MBL-CNA2693S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 722-822 of human NTRK2 (Q16620 ).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2649]
Molekulargewicht: 140kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 722-822 of human NTRK2 (Q16620 ).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200