DLK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2715S
Artikelname: DLK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2715S
Hersteller Artikelnummer: CNA2715S
Alternativnummer: MBL-CNA2715S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-303 of human DLK1 (P80370).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 41kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 24-303 of human DLK1 (P80370).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100