EGF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2720S
Artikelname: EGF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2720S
Hersteller Artikelnummer: CNA2720S
Alternativnummer: MBL-CNA2720S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 134kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2).
Application Verdünnung: WB: DB,1:500 - 1:2000|WB,1:500 - 1:2000